| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TSP50 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TSP50 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TSP50. This antibody reacts with human. The TSP50 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TSP50 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GLSKADGMWPQFRTIQEKEVIILNNKECDNFYHNFTKIPTLVQIIKSQMMCAEDTHREKFCYELTGEPLVCSMEGTWYL |
|---|
| Other Names | Cancer/testis antigen 20, CT20probable threonine protease PRSS50, EC 3.4.25.-, protease, serine, 50, Serine protease 50, testes-specific protease 50, Testis-specific protease-like protein 50, TSP50testes specific protease 50 |
|---|
| Gene, Accession # | PRSS50, Gene ID: 29122, Accession: Q9UI38, SwissProt: Q9UI38 |
|---|
| Catalog # | NBP2-34204 |
|---|
| Price | |
|---|
| Order / More Info | TSP50 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|