| Edit |   |
|---|
| Antigenic Specificity | DBX2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DBX2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DBX2. This antibody reacts with human. The DBX2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human DBX2The immunogen for this antibody is DBX2. Peptide sequence ALLNLPAAPGFGNLGKSFLIENLLRVGGAPTPRLQPPAPHDPATALATAG. |
|---|
| Other Names | developing brain homeobox 2, developing brain homeobox protein 2, FLJ16139, homeobox protein DBX2 |
|---|
| Gene, Accession # | DBX2, Gene ID: 440097, Accession: NP_001004329, SwissProt: NP_001004329 |
|---|
| Catalog # | NBP1-79212-20ul |
|---|
| Price | |
|---|
| Order / More Info | DBX2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|