| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DBPA |
|---|
| Clone | 1H5 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DBPA Antibody (1H5) from Novus Biologicals is a mouse monoclonal antibody to DBPA. This antibody reacts with human. The DBPA Antibody (1H5) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | CSDA (NP_003642 241 a.a. - 330 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGPVHRNPTYRPRYRSRGPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYR |
|---|
| Other Names | cold shock domain protein A, Cold shock domain-containing protein A, cold-shock domain protein A, CSDA1, dbpA, DBPAcold-shock domain containing A1, DNA-binding protein A, Single-strand DNA-binding protein NF-GMB, ZO-1-associated nucleic acid-binding protein, ZONAB |
|---|
| Gene, Accession # | YBX3, Gene ID: 8531, Accession: NP_003642, SwissProt: NP_003642 |
|---|
| Catalog # | H00008531-M06 |
|---|
| Price | |
|---|
| Order / More Info | DBPA Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|