| 产品详情 |
| Edit |   |
| Antigenic Specificity | Laminin gamma 1 |
| Clone | M1 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2a kappa |
| Format | ascites, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA, Proximity Ligation Assay. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Laminin gamma 1 Antibody (M1) from Novus Biologicals is a mouse monoclonal antibody to Laminin gamma 1. This antibody reacts with human. The Laminin gamma 1 Antibody (M1) has been validated for the following applications: Western Blot, ELISA, Proximity Ligation Assay. |
| Immunogen | LAMC1 (AAH15586, 1 a.a. - 38 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNKRRTSHRIWKNKLPEYMRRPKGPVTKLWRSMPAWLS |
| Other Names | LAMB2Laminin-7 subunit gamma, Laminin B2 chain, laminin subunit gamma-1, laminin, gamma 1 (formerly LAMB2), Laminin-1 subunit gamma, Laminin-10 subunit gamma, Laminin-11 subunit gamma, Laminin-2 subunit gamma, Laminin-3 subunit gamma, Laminin-4 subunit gamma, Laminin-6 subunit gamma, Laminin-8 subunit gamma, Laminin-9 subunit gamma, MGC87297, S-LAM gamma, S-laminin subunit gamma |
| Gene, Accession # | LAMC1, Gene ID: 3915, Accession: AAH15586, SwissProt: AAH15586 |
| Catalog # | H00003915-M03 |
| Price | |
| Order / More Info | Laminin gamma 1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|