| Edit |   |
|---|
| Antigenic Specificity | Latent TGF-beta bp1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Latent TGF-beta bp1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Latent TGF-beta bp1. This antibody reacts with human. The Latent TGF-beta bp1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human LTBP1The immunogen for this antibody is LTBP1. Peptide sequence NVCANGDCSNLEGSYMCSCHKGYTRTPDHKHCRDIDECQQGNLCVNGQCK. |
|---|
| Other Names | latent transforming growth factor beta binding protein 1, latent-transforming growth factor beta-binding protein 1, LTBP-1, MGC163161, TGF-beta1-BP-1, Transforming growth factor beta-1-binding protein 1 |
|---|
| Gene, Accession # | LTBP1, Gene ID: 4052, Accession: NP_000618, SwissProt: NP_000618 |
|---|
| Catalog # | NBP1-79806 |
|---|
| Price | |
|---|
| Order / More Info | Latent TGF-beta bp1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|