| 产品详情 |
| Edit |   |
| Antigenic Specificity | LAT3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LAT3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LAT3. This antibody reacts with human. The LAT3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human LAT3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NCTLNWPIEAFPAPEEVNYTKKIKLSGLALDHKVTGDLFYTHVTTMGQRLSQKAPSLEDGSDAFMSPQDVRGTSENLPERSVPLRKSLCS |
| Other Names | LAT3prostate cancer overexpressed gene 1, PB39L-type amino acid transporter 3, POV1large neutral amino acids transporter small subunit 3, Prostate cancer overexpressed gene 1 protein, R00504, Solute carrier family 43 member 1, solute carrier family 43, member 1 |
| Gene, Accession # | SLC43A1, Gene ID: 8501 |
| Catalog # | NBP1-87332 |
| Price | |
| Order / More Info | LAT3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|