| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GABA-A R delta |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Western blot reported in scientific literature (PMID 29020412). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GABA-A R delta Antibody from Novus Biologicals is a rabbit polyclonal antibody to GABA-A R delta. This antibody reacts with human. The GABA-A R delta Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human GABA-A R delta antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KVKVSRPRAEMDVRNAIVLFSLSAAGVTQELAISRRQRRVPGNLMGSYRSVGVETGETKKEGAARSGGQGGIRARL |
|---|
| Other Names | EIG10, EJM7, GABA(A) receptor subunit delta, GABA-A receptor, delta polypeptide, gamma-aminobutyric acid (GABA) A receptor, delta, gamma-aminobutyric acid receptor subunit delta, GEFSP5, MGC45284 |
|---|
| Gene, Accession # | GABRD, Gene ID: 2563, Accession: O14764, SwissProt: O14764 |
|---|
| Catalog # | NBP2-33421 |
|---|
| Price | |
|---|
| Order / More Info | GABA-A R delta Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 29020412 |
|---|
| 产品资料 |
|
|