| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Tryptase gamma-1/TPSG1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Tryptase gamma-1/TPSG1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Tryptase gamma-1/TPSG1. This antibody reacts with human. The Tryptase gamma-1/TPSG1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Tryptase gamma-1/TPSG1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLCAR |
|---|
| Other Names | EC 3.4.21, EC 3.4.21.-, gamma I, gamma II, lung tryptase, mast cell protease II, mast cell tryptase, PRSS31skin tryptase, Serine protease 31, TMTpituitary tryptase, Transmembrane tryptase, trpA, tryptase gamma, tryptase gamma 1, tryptase gamma I, tryptase gamma II |
|---|
| Gene, Accession # | TPSG1, Gene ID: 25823, Accession: Q9NRR2, SwissProt: Q9NRR2 |
|---|
| Catalog # | NBP2-37977 |
|---|
| Price | |
|---|
| Order / More Info | Tryptase gamma-1/TPSG1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|