| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Tryptase beta-2/TPSB2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Tryptase beta-2/TPSB2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Tryptase beta-2/TPSB2. This antibody reacts with human. The Tryptase beta-2/TPSB2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TPSB2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VKVPIMENHICDAKYHLGAYTGDDVRIVRD |
|---|
| Other Names | EC 3.4.21, EC 3.4.21.59, mast cell tryptase beta II, mast cell tryptase beta III, TPS2tryptase beta-2, tryptase beta 2, tryptase beta 2 (gene/pseudogene), tryptase beta II, tryptase beta III, Tryptase II, tryptase III, tryptase-2, tryptaseB, tryptaseC |
|---|
| Gene, Accession # | TPSB2, Gene ID: 64499, Accession: P20231, SwissProt: P20231 |
|---|
| Catalog # | NBP2-33551 |
|---|
| Price | |
|---|
| Order / More Info | Tryptase beta-2/TPSB2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|