| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | JunD |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The JunD Antibody from Novus Biologicals is a rabbit polyclonal antibody to JunD. This antibody reacts with human. The JunD Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human JunD antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGFVKALED |
|---|
| Other Names | activator protein 1, AP-1, jun D proto-oncogene, JunD-FL isoform, transcription factor jun-D |
|---|
| Gene, Accession # | JUND, Gene ID: 3727, Accession: P17535, SwissProt: P17535 |
|---|
| Catalog # | NBP2-38983 |
|---|
| Price | |
|---|
| Order / More Info | JunD Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|