| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ELTD1/ETL |
|---|
| Clone | CL4164 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ELTD1/ETL Antibody (CL4164) from Novus Biologicals is a mouse monoclonal antibody to ELTD1/ETL. This antibody reacts with human. The ELTD1/ETL Antibody (CL4164) has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ELTD1/ETL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ENANCTNTEGSYYCMCVPGFRSSSNQDRFITNDGTVCIENVNANCHLDNVCIAANINKTLTKIRSIKEPVALLQEVYRNSVTDLSPTDIITYIEILAESSSLLGYKNNTIS |
|---|
| Other Names | EGF, latrophilin and seven transmembrane domain containing 1, EGF, latrophilin and seven transmembrane domain-containing protein 1, ETL protein, ETLEGF-TM7-latrophilin-related protein, KPG_003 |
|---|
| Gene, Accession # | ADGRL4, Gene ID: 64123 |
|---|
| Catalog # | NBP2-59041 |
|---|
| Price | |
|---|
| Order / More Info | ELTD1/ETL Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|