| Edit |   |
|---|
| Antigenic Specificity | LRMDA |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LRMDA Antibody from Novus Biologicals is a rabbit polyclonal antibody to LRMDA. This antibody reacts with human. The LRMDA Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ELILDNNQLGDDLVLPGLPRLHTLTLNKNRITDLENLLDHLAEVTPALEY LSLLGNVACPNELVSLEKDEEDYKRYRCFVLYK |
|---|
| Other Names | C10orf11, C10orf11 chromosome 10 open reading frame 11, CDA017 |
|---|
| Gene, Accession # | C10orf11, Gene ID: 83938 |
|---|
| Catalog # | NBP2-14370 |
|---|
| Price | |
|---|
| Order / More Info | LRMDA Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|