| Edit |   |
|---|
| Antigenic Specificity | LRIF1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LRIF1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LRIF1. This antibody reacts with human. The LRIF1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C1ORF103 The peptide sequence was selected from the middle region of C1ORF103. Peptide sequence SHSKTRQEKRTEMEYYTHEKQEKGTLNSNAAYEQSHFFNKNYTEDIFPVT. |
|---|
| Other Names | ligand-dependent nuclear receptor-interacting factor 1, RP11-96K19.1, C1orf103, ligand dependent nuclear receptor interacting factor 1, RIF1 |
|---|
| Gene, Accession # | LRIF1, Gene ID: 55791, Accession: Q5T3J3, SwissProt: Q5T3J3 |
|---|
| Catalog # | NBP1-56659 |
|---|
| Price | |
|---|
| Order / More Info | LRIF1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|