| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Aurora B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Aurora B Antibody from Novus Biologicals is a rabbit polyclonal antibody to Aurora B. This antibody reacts with human. The Aurora B Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Aurora B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: WPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTID |
|---|
| Other Names | AIK2EC 2.7.11.1, AIM1Aik2, AIM-1STK-1, ARK2ARK-2, AurB, aurkb-sv2, Aurora- and IPL1-like midbody-associated protein 1, aurora kinase BSerine/threonine-protein kinase aurora-B, aurora kinase B-Sv1, aurora kinase B-Sv2, Aurora/IPL1-related kinase 2, aurora-1, aurora-B, Aurora-related kinase 2, EC 2.7.11, IPL1, serine/threonine kinase 12, serine/threonine-protein kinase 12, STK12aurkb-sv1, STK5 |
|---|
| Gene, Accession # | AURKB, Gene ID: 9212 |
|---|
| Catalog # | NBP2-55144 |
|---|
| Price | |
|---|
| Order / More Info | Aurora B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|