| Edit |   |
|---|
| Antigenic Specificity | STX19 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The STX19 Antibody from Novus Biologicals is a rabbit polyclonal antibody to STX19. This antibody reacts with human. The STX19 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to STX19(syntaxin 19) The peptide sequence was selected from the N terminal of STX19 (NP_001001850). Peptide sequence LQQAVIYEREPVAERHLHEIQKLQESINNLADNVQKFGQQQKSLVASMRR. |
|---|
| Other Names | MGC21382, syntaxin 19, syntaxin-19 |
|---|
| Gene, Accession # | STX19, Gene ID: 415117, Accession: Q8N4C7, SwissProt: Q8N4C7 |
|---|
| Catalog # | NBP1-56467 |
|---|
| Price | |
|---|
| Order / More Info | STX19 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|