| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | STT3B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The STT3B Antibody from Novus Biologicals is a rabbit polyclonal antibody to STT3B. This antibody reacts with human. The STT3B Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human STT3B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KAPDNRETLDHKPRVTNIFPKQKYLSKKTTKRKRGYIK |
|---|
| Other Names | FLJ90106, homolog of yeast STT3, Oligosaccharyl transferase subunit STT3B, SIMPEC 2.4.1.119, source of immunodominant MHC associated peptides, Source of immunodominant MHC-associated peptides homolog, STT3, subunit of the oligosaccharyltransferase complex, homolog B (S.cerevisiae), STT3-Bdolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B |
|---|
| Gene, Accession # | STT3B, Gene ID: 201595 |
|---|
| Catalog # | NBP2-48657 |
|---|
| Price | |
|---|
| Order / More Info | STT3B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|