| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | STT3A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The STT3A Antibody from Novus Biologicals is a rabbit polyclonal antibody to STT3A. This antibody reacts with human. The STT3A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human STT3A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VRIGGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKR |
|---|
| Other Names | Integral membrane protein 1EC 2.4.1.119, integral transmembrane protein 1, ITM1dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A, MGC9042, Oligosaccharyl transferase subunit STT3A, STT3, subunit of the oligosaccharyltransferase complex, homolog A (S.cerevisiae), STT3-AFLJ27038, TMCB5, transmembrane conserved, Transmembrane protein TMC |
|---|
| Gene, Accession # | STT3A, Gene ID: 3703 |
|---|
| Catalog # | NBP1-81576 |
|---|
| Price | |
|---|
| Order / More Info | STT3A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|