| 产品详情 |
| Edit |   |
| Antigenic Specificity | ST6 Sialyltransferase 6/ST6GALNAC6 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ST6 Sialyltransferase 6/ST6GALNAC6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ST6 Sialyltransferase 6/ST6GALNAC6. This antibody reacts with human. The ST6 Sialyltransferase 6/ST6GALNAC6 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to ST6GALNAC6(ST6 -N-acetylgalactosaminide alpha-2,6-sialyltransferase 6) The peptide sequence was selected from the C terminal of ST6GALNAC6. Peptide sequence YHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGIT |
| Other Names | alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6, CMP-NeuAC:(beta)-N-acetylgalactosaminide (alpha)2,6-sialyltransferase member VI, EC 2.4.99, EC 2.4.99.-, EC 2.4.99.7, GalNAc alpha-2,6-sialyltransferase VI, hST6GalNAc VI, RP11-203J24.3, Sialyltransferase 7F, sialytransferase 7 ((alpha-N-acetylneuraminyl 2,3-betagalactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialytransferase) F, SIAT7F, SIAT7-F, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 6, ST6GalNAc VI, ST6GalNAcVI |
| Gene, Accession # | ST6GALNAC6, Gene ID: 30815, Accession: Q969X2, SwissProt: Q969X2 |
| Catalog # | NBP1-59959-20ul |
| Price | |
| Order / More Info | ST6 Sialyltransferase 6/ST6GALNAC6 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|