| 产品详情 |
| Edit |   |
| Antigenic Specificity | ST8SIA5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ST8SIA5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ST8SIA5. This antibody reacts with human. The ST8SIA5 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ST8SIA5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SGLYITHHYYDNVKPRPGFHAMPSEIFNFLHLHSRGILRVHTGTCS |
| Other Names | alpha-2,8-sialyltransferase 8E, EC 2.4.99.-, MGC119670, Sialyltransferase 8E, sialyltransferase 8E (alpha-2, 8-polysialytransferase), Sialytransferase St8Sia V, SIAT8-E, SIAT8EMGC119671, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 5, ST8SiaV |
| Gene, Accession # | ST8SIA5, Gene ID: 29906, Accession: O15466, SwissProt: O15466 |
| Catalog # | NBP2-30530 |
| Price | |
| Order / More Info | ST8SIA5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|