| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ST8SIA3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ST8SIA3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ST8SIA3. This antibody reacts with human. The ST8SIA3 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ST8SIA3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: WPFGFDPNTREDLPYHYYDKKGTKFTTKWQESHQLPAEFQLLYRMHGEGLTKLTLSHCA |
|---|
| Other Names | Alpha-2,8-sialyltransferase 8C, Alpha-2,8-sialyltransferase III, EC 2.4.99.-, sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase, Sialyltransferase 8C, sialyltransferase 8C (alpha2,3Galbeta1,4GlcNAcalpha 2,8-sialyltransferase), Sialytransferase St8Sia III, SIAT8-C, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 3SIAT8C, ST8SiaIII |
|---|
| Gene, Accession # | ST8SIA3, Gene ID: 51046 |
|---|
| Catalog # | NBP2-56457 |
|---|
| Price | |
|---|
| Order / More Info | ST8SIA3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|