| 产品详情 |
| Edit |   |
| Antigenic Specificity | FUBI/MNSF beta/FAU |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FUBI/MNSF beta/FAU Antibody from Novus Biologicals is a rabbit polyclonal antibody to FUBI/MNSF beta/FAU. This antibody reacts with human. The FUBI/MNSF beta/FAU Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | Synthetic peptides corresponding to FAU(Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed) The peptide sequence was selected from the middle region of FAU. Peptide sequence VRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGK |
| Other Names | 40S ribosomal protein S30, asr1, FAU1, FAU-encoded ubiquitin-like protein, FBR-MuSV-associated ubiquitously expressed, Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed, Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed(fox derived), FLJ22986, Fub1, Fubi, MNSFbeta, monoclonal nonspecific suppressor factor beta, ribosomal protein S30, RPS30, ubiquitin-like protein fubi and ribosomal protein S30, ubiquitin-like-S30 fusion protein |
| Gene, Accession # | FAU, Gene ID: 2197, Accession: P62861, SwissProt: P62861 |
| Catalog # | NBP1-55090-20ul |
| Price | |
| Order / More Info | FUBI/MNSF beta/FAU Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 26834700 |
| 产品资料 |
|
|