| 产品详情 |
| Edit |   |
| Antigenic Specificity | FTSJD2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FTSJD2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FTSJD2. This antibody reacts with human. The FTSJD2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human FTSJD2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GKPLVKDREAELLYFADVCAGPGGFSEYVLWRKKWHAKGFGMTLKGPNDFKLEDFYSASSELFEPYYGEGGIDGDGDITRPENISAFRNFVL |
| Other Names | Cap1 2'O-ribose methyltransferase 1, cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1, EC 2.1.1.57, FtsJ methyltransferase domain containing 2, FtsJ methyltransferase domain-containing protein 2, hMTr1, Interferon-stimulated gene 95 kDa protein, ISG95, KIAA0082FLJ22156, MTR1, S-adenosyl-L-methionine-dependent methyltransferase FTSJD2 |
| Gene, Accession # | FTSJD2, Gene ID: 23070 |
| Catalog # | NBP1-83048 |
| Price | |
| Order / More Info | FTSJD2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|