| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FTSJ2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FTSJ2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FTSJ2. This antibody reacts with human. The FTSJ2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human FTSJ2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DPSSPVGFVLGVDLLHIFPLEGATFLCPADVTDPRTSQRILEVLPGRRADVILSDMAPNATGFRDLDHDRLI |
|---|
| Other Names | DKFZp686J14194, EC 2.1.1.-, FJH1cell division protein FtsJ, FtsJ homolog 2 (E. coli), Protein ftsJ homolog 2, putative ribosomal RNA methyltransferase 2, rRNA (uridine-2'-O-)-methyltransferase |
|---|
| Gene, Accession # | FTSJ2, Gene ID: 29960, Accession: Q9UI43, SwissProt: Q9UI43 |
|---|
| Catalog # | NBP2-30601 |
|---|
| Price | |
|---|
| Order / More Info | FTSJ2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|