| Edit |   |
|---|
| Antigenic Specificity | FTO |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FTO Antibody from Novus Biologicals is a rabbit polyclonal antibody to FTO. This antibody reacts with mouse. The FTO Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to Fto (fat mass and obesity associated) The peptide sequence was selected from the N terminal of Fto. Peptide sequence MKRVQTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLV. |
|---|
| Other Names | alpha-ketoglutarate-dependent dioxygenase FTO, EC 1.14.11.-, fat mass and obesity associated, Fat mass and obesity-associated protein, KIAA1752protein fto, MGC5149 |
|---|
| Gene, Accession # | FTO, Gene ID: 79068, Accession: Q8BGW1 |
|---|
| Catalog # | NBP1-69021 |
|---|
| Price | |
|---|
| Order / More Info | FTO Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|