| Edit |   |
|---|
| Antigenic Specificity | FTHL17 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FTHL17 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FTHL17. This antibody reacts with human. The FTHL17 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to FTHL17(ferritin, heavy polypeptide-like 17) The peptide sequence was selected from the middle region of FTHL17. Peptide sequence FLESHYLHEQVKTIKELGGYVSNLRKICSPEAGLAEYLFDKLTLGGRVKE. |
|---|
| Other Names | CT38Cancer/testis antigen 38, ferritin heavy polypeptide-like 17, ferritin, heavy polypeptide-like 17 |
|---|
| Gene, Accession # | FTHL17, Gene ID: 53940, Accession: Q9BXU8, SwissProt: Q9BXU8 |
|---|
| Catalog # | NBP1-59482 |
|---|
| Price | |
|---|
| Order / More Info | FTHL17 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|