| Edit |   |
|---|
| Antigenic Specificity | FSIP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FSIP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FSIP1. This antibody reacts with human. The FSIP1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to FSIP1(fibrous sheath interacting protein 1) The peptide sequence was selected from the middle region of FSIP1 (NP_689810). Peptide sequence DEKDSGLSSSEGDQSGWVVPVKGYELAVTQHQQLAEIDIKLQELSAASPT. |
|---|
| Other Names | fibrous sheath interacting protein 1, fibrous sheath-interacting protein 1, FLJ35989 |
|---|
| Gene, Accession # | FSIP1, Gene ID: 161835, Accession: Q8NA03, SwissProt: Q8NA03 |
|---|
| Catalog # | NBP1-56460-20ul |
|---|
| Price | |
|---|
| Order / More Info | FSIP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 12606363 |
|---|