| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MuRF1/TRIM63 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MuRF1/TRIM63 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MuRF1/TRIM63. This antibody reacts with human. The MuRF1/TRIM63 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TRIM63(tripartite motif-containing 63) The peptide sequence was selected from the middle region of TRIM63. Peptide sequence EQLDKSTKLVETAIQSLDEPGGATFLLTAKQLIKSIVEASKGCQLGKTEQ. |
|---|
| Other Names | EC 6.3.2.-, IRFMURF2, Iris RING finger protein, MuRF1, MuRF-1, muscle specific ring finger protein 2, Muscle-specific RING finger protein 1, RING finger protein 28FLJ32380, RNF28E3 ubiquitin-protein ligase TRIM63, SMRZMURF-1, Striated muscle RING zinc finger protein, tripartite motif containing 63, tripartite motif-containing 63, Tripartite motif-containing protein 63 |
|---|
| Gene, Accession # | TRIM63, Gene ID: 84676, Accession: Q969Q1, SwissProt: Q969Q1 |
|---|
| Catalog # | NBP1-54939 |
|---|
| Price | |
|---|
| Order / More Info | MuRF1/TRIM63 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24108784 |
|---|
| 产品资料 |
|
|