| 产品详情 |
| Edit |   |
| Antigenic Specificity | MURF2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MURF2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MURF2. This antibody reacts with human. The MURF2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MURF2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SNDRVQGVISQLEDTCKTIEECCRKQKQELCEKFDYLYGILEERKNEMTQVITRTQEEKLEHVRALIK |
| Other Names | MuRF2, MURF-2, Muscle-specific RING finger protein 2, RING finger protein 29muscle specific ring finger 2, RNF29, tripartite motif containing 55, tripartite motif-containing 55, tripartite motif-containing protein 55 |
| Gene, Accession # | TRIM55, Gene ID: 84675, Accession: Q9BYV6, SwissProt: Q9BYV6 |
| Catalog # | NBP2-33691 |
| Price | |
| Order / More Info | MURF2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 30685767 |
| 产品资料 |
|
|