| 产品详情 |
| Edit |   |
| Antigenic Specificity | Cytochrome P450 3A4/3A5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Cytochrome P450 3A4/3A5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cytochrome P450 3A4/3A5. This antibody reacts with human. The Cytochrome P450 3A4/3A5 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to CYP3A4(cytochrome P450, family 3, subfamily A, polypeptide 4) The peptide sequence was selected from the middle region of CYP3A4 (NP_059488). Peptide sequence MIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIG. |
| Other Names | Albendazole monooxygenase, Albendazole sulfoxidase, CP33, CP34, CYP3A, CYP3A3, CYPIIIA3, CYPIIIA4, Cytochrome P450 3A3, cytochrome P450 3A4, Cytochrome P450 HLp, Cytochrome P450 NF-25, cytochrome P450, family 3, subfamily A, polypeptide 4, cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 3, cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 4, Cytochrome P450-PCN1, EC 1.14.13.32, EC 1.14.13.67, EC 1.14.13.97, EC 1.14.14.1, glucocorticoid-inducible P450, HLP, MGC126680, NF-25, Nifedipine oxidase, P450C3, P450-III, steroid inducible, P450PCN1, Quinine 3-monooxygenase, Taurochenodeoxycholate 6-alpha-hydroxylase |
| Gene, Accession # | CYP3A4, Gene ID: 1576, Accession: P08684, SwissProt: P08684 |
| Catalog # | NBP1-69667 |
| Price | |
| Order / More Info | Cytochrome P450 3A4/3A5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|