| Edit |   |
| Antigenic Specificity | Proprotein convertase PC4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Proprotein convertase PC4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Proprotein convertase PC4. This antibody reacts with human. The Proprotein convertase PC4 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to PCSK4(proprotein convertase subtilisin/kexin type 4) The peptide sequence was selected from the N terminal of PCSK4. Peptide sequence VSSWAVQVSQGNREVERLARKFGFVNLGPIFPDGQYFHLRHRGVVQQSLT. |
| Other Names | DKFZp434B217, EC 3.4.21, EC 3.4.21.75, EC 3.4.21.93, MGC34749, PC4EC 3.4.21.-, Proprotein convertase 4, proprotein convertase subtilisin/kexin type 4, SPC5 |
| Gene, Accession # | PCSK4, Gene ID: 54760, Accession: Q6UW60, SwissProt: Q6UW60 |
| Catalog # | NBP1-55224 |
| Price | |
| Order / More Info | Proprotein convertase PC4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |