| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Integrin alpha E/CD103 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Integrin alpha E/CD103 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Integrin alpha E/CD103. This antibody reacts with human. The Integrin alpha E/CD103 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Integrin alpha E/CD103 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CEEDCFSNASVKVSYQLQTPEGQTDHPQPILDRYTEPFAIFQLPYEKACKNKLFCVAELQLATTVSQQELVVGLTKELTLN |
|---|
| Other Names | antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide, CD103, CD103 antigen, HML-1 antigen, HUMINAE, integrin alpha-E, Integrin alpha-IEL, integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1; alphapolypeptide), MGC141996, Mucosal lymphocyte 1 antigen |
|---|
| Gene, Accession # | ITGAE, Gene ID: 3682, Accession: P38570, SwissProt: P38570 |
|---|
| Catalog # | NBP1-88142 |
|---|
| Price | |
|---|
| Order / More Info | Integrin alpha E/CD103 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|