| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Cytochrome P450 2C8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Cytochrome P450 2C8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cytochrome P450 2C8. This antibody reacts with human. The Cytochrome P450 2C8 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Cytochrome P450 2C8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQICFIPV |
|---|
| Other Names | CPC8, CYPIIC8, cytochrome P450 2C8, Cytochrome P450 form 1, Cytochrome P450 IIC2, Cytochrome P450 MP-12, Cytochrome P450 MP-20, cytochrome P450, family 2, subfamily C, polypeptide 8, cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 8, EC 1.14.14.1, flavoprotein-linked monooxygenase, microsomal monooxygenase, MP-12/MP-20, P450 form 1, S-mephenytoin 4-hydroxylase, xenobiotic monooxygenase |
|---|
| Gene, Accession # | CYP2C8, Gene ID: 1558 |
|---|
| Catalog # | NBP1-88055 |
|---|
| Price | |
|---|
| Order / More Info | Cytochrome P450 2C8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|