| 产品详情 |
| Edit |   |
| Antigenic Specificity | Cytochrome P450 2C18 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Cytochrome P450 2C18 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cytochrome P450 2C18. This antibody reacts with human. The Cytochrome P450 2C18 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to CYP2C18(cytochrome P450, family 2, subfamily C, polypeptide 18) The peptide sequence was selected from the N terminal of CYP2C18. Peptide sequence MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDM. |
| Other Names | (S)-mephenytoin hydroxylase associated cytochrome P450, CPCI, CYP2C, CYP2C17, CYPIIC18, cytochrome P450 2C18, cytochrome P450, family 2, subfamily C, polypeptide 18, cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 17, cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 18, Cytochrome P450-6b/29c, DKFZp686I24235, EC 1.14.14.1, flavoprotein-linked monooxygenase, microsomal monooxygenase, P450-6B/29C, P450IIC17, unspecific monooxygenase |
| Gene, Accession # | CYP2C18, Gene ID: 1562, Accession: P33260, SwissProt: P33260 |
| Catalog # | NBP1-57975-20ul |
| Price | |
| Order / More Info | Cytochrome P450 2C18 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|