| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ALDH1A3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ALDH1A3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ALDH1A3. This antibody reacts with human. The ALDH1A3 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ALDH1A3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TLAALETMDTGKPFLHAFFIDLEGCIRTLRYF |
|---|
| Other Names | aldehyde dehydrogenase 1 family, member A3, Aldehyde dehydrogenase 6, aldehyde dehydrogenase family 1 member A3, ALDH1A6, ALDH6acetaldehyde dehydrogenase 6, EC 1.2.1, EC 1.2.1.5, RalDH3, RALDH-3, Retinaldehyde dehydrogenase 3 |
|---|
| Gene, Accession # | ALDH1A3, Gene ID: 220 |
|---|
| Catalog # | NBP2-56464 |
|---|
| Price | |
|---|
| Order / More Info | ALDH1A3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|