| 产品详情 |
| Edit |   |
| Antigenic Specificity | Proapoptotic Caspase Adaptor Protein |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Proapoptotic Caspase Adaptor Protein Antibody from Novus Biologicals is a rabbit polyclonal antibody to Proapoptotic Caspase Adaptor Protein. This antibody reacts with human. The Proapoptotic Caspase Adaptor Protein Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Proapoptotic Caspase Adaptor Protein antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRS |
| Other Names | caspase-2 binding protein, FLJ32987, HSPC190, marginal zone B and B1 cell-specific protein, MGC29506, PACAP, pERp1, plasma cell-induced ER protein 1, plasma cell-induced resident endoplasmic reticulum protein, Plasma cell-induced resident ER protein, Proapoptotic caspase adapter protein, proapoptotic caspase adaptor protein |
| Gene, Accession # | MZB1, Gene ID: 51237 |
| Catalog # | NBP2-55874 |
| Price | |
| Order / More Info | Proapoptotic Caspase Adaptor Protein Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|