| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PRMT8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PRMT8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PRMT8. This antibody reacts with human. The PRMT8 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PRMT8(protein arginine methyltransferase 8) The peptide sequence was selected from the C terminal of PRMT8 (NP_872294). Peptide sequence YLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSND. |
|---|
| Other Names | EC 2.1.1, EC 2.1.1.-, EC 2.1.1.77, Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 4, HMT1 hnRNP methyltransferase-like 3, HMT1 hnRNP methyltransferase-like 3 (S. cerevisiae), HMT1 hnRNP methyltransferase-like 4, HMT1 hnRNP methyltransferase-like 4 (S. cerevisiae), HRMT1L3, HRMT1L4, protein arginine methyltransferase 8, protein arginine N-methyltransferase 4, protein arginine N-methyltransferase 8 |
|---|
| Gene, Accession # | PRMT8, Gene ID: 56341, Accession: Q9NR22, SwissProt: Q9NR22 |
|---|
| Catalog # | NBP1-55401-20ul |
|---|
| Price | |
|---|
| Order / More Info | PRMT8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|