| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PRMT6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PRMT6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PRMT6. This antibody reacts with human. The PRMT6 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PRMT6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: WKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPRRLRVLLRYKVGDQEEKTKDFAME |
|---|
| Other Names | EC 2.1.1.-, EC 2.1.1.125, FLJ10559, FLJ51477, Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 6, Histone-arginine N-methyltransferase PRMT6, HMT1 hnRNP methyltransferase-like 6, HMT1 hnRNP methyltransferase-like 6 (S. cerevisiae), HRMT1L6, protein arginine methyltransferase 6, protein arginine N-methyltransferase 6 |
|---|
| Gene, Accession # | PRMT6, Gene ID: 55170 |
|---|
| Catalog # | NBP2-32459 |
|---|
| Price | |
|---|
| Order / More Info | PRMT6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|