| Edit |   |
|---|
| Antigenic Specificity | ADAD2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ADAD2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ADAD2. This antibody reacts with human. The ADAD2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to ADAD2(adenosine deaminase domain containing 2) The peptide sequence was selected from the middle region of ADAD2. Peptide sequence GQQLHDCHGLVIARRALLRFLFRQLLLATQGGPKGKEQSVLAPQPGPGPP. |
|---|
| Other Names | adenosine deaminase domain containing 2, adenosine deaminase domain-containing protein 2, TENRLFLJ00337, Testis nuclear RNA-binding protein-like |
|---|
| Gene, Accession # | ADAD2, Gene ID: 161931, Accession: Q8NCV1, SwissProt: Q8NCV1 |
|---|
| Catalog # | NBP1-57403 |
|---|
| Price | |
|---|
| Order / More Info | ADAD2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|