| Edit |   |
| Antigenic Specificity | ADAD2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ADAD2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ADAD2. This antibody reacts with human. The ADAD2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to ADAD2(adenosine deaminase domain containing 2) The peptide sequence was selected from the C terminal of ADAD2. Peptide sequence TPDTCRGLSLNWSLGDPGIEVVDVATGRVKANAALGPPSRLCKASFLRAF. |
| Other Names | adenosine deaminase domain containing 2, adenosine deaminase domain-containing protein 2, TENRLFLJ00337, Testis nuclear RNA-binding protein-like |
| Gene, Accession # | ADAD2, Gene ID: 161931, Accession: Q8NCV1, SwissProt: Q8NCV1 |
| Catalog # | NBP1-57511-20ul |
| Price | |
| Order / More Info | ADAD2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |