| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ADA2 beta |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ADA2 beta Antibody from Novus Biologicals is a rabbit polyclonal antibody to ADA2 beta. This antibody reacts with human. The ADA2 beta Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ADA2 beta antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KKYCVYCLAEVSPLRFRCTECQDIELCPECFSAGAEIGHHRRYHGYQLVDGGRFTLWGPEAEGGWTSRE |
|---|
| Other Names | ADA2-beta, ADA2-like protein beta, MGC21874, transcriptional adapter 2-beta, transcriptional adaptor 2 (ADA2 homolog, yeast)-beta, transcriptional adaptor 2B |
|---|
| Gene, Accession # | TADA2B, Gene ID: 93624, Accession: Q86TJ2, SwissProt: Q86TJ2 |
|---|
| Catalog # | NBP1-91649 |
|---|
| Price | |
|---|
| Order / More Info | ADA2 beta Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|