| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ADA2a |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ADA2a Antibody from Novus Biologicals is a rabbit polyclonal antibody to ADA2a. This antibody reacts with human. The ADA2a Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ADA2a antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MDRLGPFSNDPSDKPPCRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGFEYKKHQSDHTYEIMTSD |
|---|
| Other Names | ADA2AFLJ12705, ADA2-like protein, hADA2, TADA2LADA2, transcriptional adapter 2-alpha, Transcriptional adapter 2-like, transcriptional adaptor 2 (ADA2 homolog, yeast)-like, transcriptional adaptor 2 alpha, transcriptional adaptor 2A |
|---|
| Gene, Accession # | TADA2A, Gene ID: 6871 |
|---|
| Catalog # | NBP2-57507 |
|---|
| Price | |
|---|
| Order / More Info | ADA2a Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|