| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ACE-2 |
|---|
| Clone | CL4013 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ACE-2 Antibody (CL4013) from Novus Biologicals is a mouse monoclonal antibody to ACE-2. This antibody reacts with human. The ACE-2 Antibody (CL4013) has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ACE-2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSED |
|---|
| Other Names | ACEHangiotensin I converting enzyme 2, ACE-related carboxypeptidase, angiotensin I converting enzyme (peptidyl-dipeptidase A) 2, angiotensin-converting enzyme 2, Angiotensin-converting enzyme homolog, DKFZp434A014, EC 3.4.17, EC 3.4.17.23, Metalloprotease MPROT15 |
|---|
| Gene, Accession # | ACE2, Gene ID: 59272 |
|---|
| Catalog # | NBP2-59036 |
|---|
| Price | |
|---|
| Order / More Info | ACE-2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|