| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FOLR1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FOLR1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FOLR1. This antibody reacts with human. The FOLR1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to FOLR1(folate receptor 1 (adult)) The peptide sequence was selected from the middle region of FOLR1. Peptide sequence HFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARF. |
|---|
| Other Names | Adult folate-binding protein, FBP, folate binding protein, Folate receptor 1, folate receptor 1 (adult), folate receptor alpha, Folate receptor, adult, FOLR, FR-alpha, KB cells FBP, Ovarian tumor-associated antigen MOv18 |
|---|
| Gene, Accession # | FOLR1, Gene ID: 2348, Accession: P15328, SwissProt: P15328 |
|---|
| Catalog # | NBP1-69363 |
|---|
| Price | |
|---|
| Order / More Info | FOLR1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|