| Edit |   |
|---|
| Antigenic Specificity | Stanniocalcin 1/STC-1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry-Paraffin. Use in Immunohistochemistry-Paraffin reported in scientific literature (PMID 25647164) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Stanniocalcin 1/STC-1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Stanniocalcin 1/STC-1. This antibody reacts with human, mouse. The Stanniocalcin 1/STC-1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to STC1(stanniocalcin 1) The peptide sequence was selected from the N terminal of STC1 (NP_003146). Peptide sequence MLQNSAVLLVLVISASATHEAEQNDSVSPRKSRVAAQNSAEVVRCLNSAL. |
|---|
| Other Names | stanniocalcin 1, stanniocalcin-1, STCSTC-1 |
|---|
| Gene, Accession # | STC1, Gene ID: 6781, Accession: P52823, SwissProt: P52823 |
|---|
| Catalog # | NBP1-59310 |
|---|
| Price | |
|---|
| Order / More Info | Stanniocalcin 1/STC-1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25647164 |
|---|