| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | STAMP2/STEAP4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The STAMP2/STEAP4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to STAMP2/STEAP4. This antibody reacts with human. The STAMP2/STEAP4 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human STAMP2/STEAP4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSD |
|---|
| Other Names | EC 1.16.1, EC 1.16.1.-, FLJ23153, Six-transmembrane epithelial antigen of prostate 4, SixTransMembrane protein of prostate 2, STAMP2DKFZp666D049, STEAP family member 4, TIARPsix transmembrane prostate protein 2, TNFAIP9, Tumor necrosis factor, alpha-induced protein 9metalloreductase STEAP4, tumor necrosis-alpha-induced adipose-related protein |
|---|
| Gene, Accession # | STEAP4, Gene ID: 79689 |
|---|
| Catalog # | NBP2-56536 |
|---|
| Price | |
|---|
| Order / More Info | STAMP2/STEAP4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|