| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | STAM2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The STAM2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to STAM2. This antibody reacts with human. The STAM2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human STAM2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PAQTSYLSTGQDTVSNPTYMNQNSNLQSATGTTAYTQQMGMSVDMSSYQNTTSNLPQLAGFPVTVPAHPVAQQHTNYHQQP |
|---|
| Other Names | DKFZp564C047, HBP, Hrs-binding protein, HSE1 homolog, signal transducing adapter molecule 2, signal transducing adaptor molecule (SH3 domain and ITAM motif) 2, STAM-2, STAM2A, STAM2B, STAM-like protein containing SH3 and ITAM domains 2 |
|---|
| Gene, Accession # | STAM2, Gene ID: 10254 |
|---|
| Catalog # | NBP1-83288 |
|---|
| Price | |
|---|
| Order / More Info | STAM2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|