| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4. This antibody reacts with human. The ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human ST8SIA4The immunogen for this antibody is ST8SIA4. Peptide sequence DVGTKSDFITMNPSVVQRAFGGFRNESDREKFVHRLSMLNDSVLWIPAFM. |
|---|
| Other Names | Alpha-2,8-sialyltransferase 8D, CMP-N-acetylneuraminate-poly-alpha-2,8-sialyl transferase, CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase, EC 2.4.99, EC 2.4.99.-, Polysialyltransferase-1, PST1MGC61459, PSTMGC34450, sialyltransferase 8 (alpha-2, 8-polysialytransferase) D, Sialyltransferase 8D, Sialytransferase St8Sia IV, SIAT8D, SIAT8-D, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4, ST8SiaIV, ST8SIA-IV |
|---|
| Gene, Accession # | ST8SIA4, Gene ID: 7903, Accession: NP_005659, SwissProt: NP_005659 |
|---|
| Catalog # | NBP1-79292 |
|---|
| Price | |
|---|
| Order / More Info | ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|