| 产品详情 |
| Edit |   |
| Antigenic Specificity | ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4. This antibody reacts with human. The ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VQRAFGGFRNESDREKFVHRLSMLNDSVLWIPAFMVKGGEKHVEWVNAL |
| Other Names | Alpha-2,8-sialyltransferase 8D, CMP-N-acetylneuraminate-poly-alpha-2,8-sialyl transferase, CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase, EC 2.4.99, EC 2.4.99.-, Polysialyltransferase-1, PST1MGC61459, PSTMGC34450, sialyltransferase 8 (alpha-2, 8-polysialytransferase) D, Sialyltransferase 8D, Sialytransferase St8Sia IV, SIAT8D, SIAT8-D, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4, ST8SiaIV, ST8SIA-IV |
| Gene, Accession # | ST8SIA4, Gene ID: 7903 |
| Catalog # | NBP2-55496 |
| Price | |
| Order / More Info | ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|