| Edit |   |
| Antigenic Specificity | POT1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The POT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to POT1. This antibody reacts with human. The POT1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human POT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LTFEGTLGAPIIPRTSSKYFNFTTEDHKMVEALRVWASTHMSPSWTLLKLCDVQPMQYFDLTCQLLGKAEVDGASFLLKVWDGTR |
| Other Names | DKFZp586D211, hPot1, POT1 protection of telomeres 1 homolog, POT1-like telomere end-binding protein, protection of telomeres 1 homolog (S. pombe), protection of telomeres protein 1 |
| Gene, Accession # | POT1, Gene ID: 25913 |
| Catalog # | NBP2-57891 |
| Price | |
| Order / More Info | POT1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |