| Edit |   |
|---|
| Antigenic Specificity | POR/Cytochrome P450 Reductase |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The POR/Cytochrome P450 Reductase Antibody from Novus Biologicals is a rabbit polyclonal antibody to POR/Cytochrome P450 Reductase. This antibody reacts with human. The POR/Cytochrome P450 Reductase Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to POR(P450 (cytochrome) oxidoreductase) The peptide sequence was selected form the middle region of POR. Peptide sequence VVHTDIDAAKVYMGEMGRLKSYENQKPPFDAKNPFLAAVTTNRKLNQGTE. |
|---|
| Other Names | CPR, CYPORFLJ26468, DKFZp686G04235, EC 1.6.2.4, NADPH--cytochrome P450 reductase, NADPH-dependent cytochrome P450 reductase, P450 (cytochrome) oxidoreductase, P450R |
|---|
| Gene, Accession # | POR, Gene ID: 5447, Accession: Q63HL4, SwissProt: Q63HL4 |
|---|
| Catalog # | NBP1-59780-20ul |
|---|
| Price | |
|---|
| Order / More Info | POR/Cytochrome P450 Reductase Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|